DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:397 Identity:93/397 - (23%)
Similarity:173/397 - (43%) Gaps:51/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFV----QRQLDAGTSELELK 179
            :...||.....:|.:.|..|||.|....::...::.:    |:|:.:    |.....|::.|::.
Human   132 LGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFN----ESVNIMHAKWQLLASEGSARLDMF 192

  Fly   180 DFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPV 244
            :..:..|.|.:....|....:..:.| :|:.:....:|........:::|||             
Human   193 EHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYI------------- 243

  Fly   245 MDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQ------EGSAES-------- 295
                  |:...|.....::|:...:|. |....:::.:|:....|      :..|:|        
Human   244 ------DFLYYLTPDGQRFRRACRLVH-DFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDV 301

  Fly   296 ---AAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLG 357
               :..:|..:.:|:|:.|:...|...|.:|.|:.||:..|.|..:||.||:...|:..:.:...
Human   302 LLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDRE 366

  Fly   358 EKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGA 422
            .|.:::|.|..:.:|...:.||||..||...|.|.|..|..|.|  |.|:   .:..:..|:|..
Human   367 PKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPD--GRVI---PKGIICLISVFG 426

  Fly   423 LHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHL 487
            .||:|..:|:||.:.|.|||.::..|.....::||..|.|:|||...|:.|:|.::...:||:.:
Human   427 THHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRV 491

  Fly   488 KPTDRTP 494
            .|....|
Human   492 LPDHTEP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 93/397 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 93/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.