DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:436 Identity:104/436 - (23%)
Similarity:174/436 - (39%) Gaps:104/436 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFV---QRQLDAGTSELELKDFFTR 184
            ||.|..::|.|....|||.|....::...:::    .::|..:   ..:||.....||:..:.:.
  Rat   132 LLLLNGKKWFQHWRMLTPAFHYGILKPYVKIM----ADSVSIMLDKWEKLDDQDHPLEIFHYVSL 192

  Fly   185 YTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNN 249
            .|.|.:...||..|.:...|.|:..::                          ||    |.|:||
  Rat   193 MTLDTVMKCAFSHQGSVQLDVNSRSYT--------------------------KA----VEDLNN 227

  Fly   250 VDYFK--------KLVF---------------------GAMKYRKEQSIVRPDMIHLLMEAQRQF 285
            :.:|:        .:::                     |.:|.||.|          |...:...
  Rat   228 LTFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQ----------LQNEEELQ 282

  Fly   286 KAEQEGSAE------SAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEK 344
            ||.::...:      .|..:|....:|:||.|:...|...|.:|.|:.:|:..|.|..:||.||:
  Rat   283 KARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQER 347

  Fly   345 LLAEILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVV 408
            ...|:.::   ||: ..:.:|.|..:.|....:.|:||.:||...|.|...|.....|..     
  Rat   348 CREEVQSI---LGDGTSVTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGR----- 404

  Fly   409 NLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEE---HKHEIRQFTYLPFGVGQRSCIGNRLA 470
            ::.:.....|.:..|||:|..:|.|:.|.|.||..:   |.|     .||||..|.|:|||.:.|
  Rat   405 SIPKGITTTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSH-----AYLPFSGGARNCIGKQFA 464

  Fly   471 LMEVKSLIFQLVLRYHLKP-TDRTPADM----MSSISGFRLLPREL 511
            :.|:|..:...:||:.|.| ..|.|..|    :.|.:|..|..::|
  Rat   465 MNELKVAVALTLLRFELLPDPTRIPVPMARLVLKSKNGIHLRLKKL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 104/436 (24%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 102/430 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.