DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP4V2

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:431 Identity:105/431 - (24%)
Similarity:185/431 - (42%) Gaps:79/431 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFF--TRY 185
            ||:....:|:..|..|||||....:....::::    |..:.:.::|:...::.....||  |..
Human   135 LLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMN----EQANILVKKLEKHINQEAFNCFFYITLC 195

  Fly   186 TNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTF------WGGLKVMLYILMPKLMKALRVPV 244
            ..|:|...|.|..:.:..:.::|:.....|:||..|      |  |.:.|:.||           
Human   196 ALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPW--LWLDLWYLM----------- 247

  Fly   245 MDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQE------GSAE--------- 294
                    ||:    ..:::|...|:......::.|...:..|.::      |||.         
Human   248 --------FKE----GWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL 300

  Fly   295 ----SAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQ 355
                |....:....:.:|:..:...|...|.:|.|..::::.|.|..|||||:|:..|:..|..:
Human   301 DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGK 365

  Fly   356 LGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQ------LKDEEGEVVVNLREDD 414
             .::|...:.|..::||.||:.|:||.:|...:..|....|.:      ||..|..::..     
Human   366 -SDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPY----- 424

  Fly   415 LVHINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIF 479
                   |||.||..||.||:|:||||..|:......:.|:||..|.|:|||.:.|:||.|: |.
Human   425 -------ALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKT-IL 481

  Fly   480 QLVLRYHLKPTDRTPADMMSSISGFRLL-PRELFWCKLESR 519
            ..:||:....:::...::  .:.|..:| |....|.||:.|
Human   482 SCILRHFWIESNQKREEL--GLEGQLILRPSNGIWIKLKRR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 101/424 (24%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 102/426 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.