DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:574 Identity:136/574 - (23%)
Similarity:224/574 - (39%) Gaps:147/574 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVELSIFVAFIGLLLYKWSVYTFGYFSKRGV---AHEKPIPLLGNIP--W------SVLMGKESY 56
            |::::..:..: |||:|.:.:   |..:|.:   ..:.|.|     |  |      |.|:.:|..
  Rat    18 FLQIATVLTVL-LLLFKTAQF---YLHRRWLLRATQQFPSP-----PSHWFFGHKLSFLVDQEFQ 73

  Fly    57 IKHSIDLHLRLKQHK------VYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFND 115
                 |:..|:|...      ::| .|:|..:|   ||:.::.: :...|..::|.......:  
  Rat    74 -----DILTRVKNFPSACPQWLWG-SNVRIQVY---DPDYMKLI-LGRSDPKSHHSYRFLAPW-- 126

  Fly   116 TSVISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVE-----AVDFVQRQLD----- 170
               |...||.|..:.|.|.|..|||.|            |:..::     ..|.|:..||     
  Rat   127 ---IGYGLLLLNGQTWFQHRRMLTPAF------------HYDTLKPYVGIMADSVRIMLDKWEQI 176

  Fly   171 -AGTSELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMP 234
             ...|.||:....|..|.|.|...||. |..|                             :.:.
  Rat   177 VGQDSTLEIFQHITLMTLDTIMKCAFS-QEGS-----------------------------VQLD 211

  Fly   235 KLMKALRVPVMDMNNVDYFK------------KLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKA 287
            :..|:....|.|:||:.:|:            .|.....|.|....:.......::...:.|.:.
  Rat   212 RKYKSYIKAVEDLNNLSFFRIRNIFHQNDIIYSLSSNGRKARSAWQLAHEHTDQVIKSRKAQLQD 276

  Fly   288 EQEGSAESAAQQDKAEF---------------NDDDLLAQCLLFFSAGFETVATCLSFTSYELMM 337
            |:|  .:...|:.:.:|               :|.||.|:...|...|.:|.|:.:|:..|.|..
  Rat   277 EEE--LQKVKQKRRLDFLDILLFARIENGSSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALAT 339

  Fly   338 NPEVQEKLLAEILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKD 401
            |||.|:....||.::   ||: ..:.:|.|..|.|....:.|:||.:||...|.||..:.....|
  Rat   340 NPEHQQGCRKEIQSL---LGDGASITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPD 401

  Fly   402 EEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEE---HKHEIRQFTYLPFGVGQRS 463
            ..     :|.:...|.::...|||:|..:|.||.|.|.||..|   |.|     ::|||..|.|:
  Rat   402 GR-----SLPKGITVMLSFYGLHHNPTVWPNPEVFDPYRFAPESSRHSH-----SFLPFSGGARN 456

  Fly   464 CIGNRLALMEVKSLIFQLVLRYHLKPTDRT------PADMMSSISGFRLLPREL 511
            |||.:.|:.|:|..:...:||:.|.| |.|      |..::.|.:|..|..::|
  Rat   457 CIGKQFAMNELKVAVALTLLRFELLP-DPTRIPIPIPRLVLKSKNGIYLRLKKL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 129/537 (24%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 120/505 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.