DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:464 Identity:104/464 - (22%)
Similarity:184/464 - (39%) Gaps:74/464 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GVFNLRDP-----LYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQ 133
            |..|:.:|     :|...||:     ....:|.|...             |.|.||.|...:|.|
  Rat    90 GFLNIYEPDYAKAVYSRGDPK-----AADVYDFFLQW-------------IGKGLLVLDGPKWFQ 136

  Fly   134 MRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFT---RYTNDVIATAAF 195
            .|..|||.|....::....:.    .|:...:..:.:...||.:..|.|.   ....|.:....|
  Rat   137 HRKLLTPGFHYDVLKPYVAIF----AESTRMMLDKWEKKASENKSFDIFCDVGHMALDTLMKCTF 197

  Fly   196 GIQVNSFKDPNNEFF--------SIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDY 252
            |...:.....:|.::        .:.|||..|.:...   .:|.|.|...:.||...:..::.|.
  Rat   198 GKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHND---FIYWLTPHGRRFLRACKIAHDHTDE 259

  Fly   253 FKKLVFGAMKYRKEQSIVRP----DMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQC 313
            ..:....|::..||:..::.    |.:.:|:..:     ::.|          .:.:|.:|.|:.
  Rat   260 VIRQRKAALQDEKERKKIQQRRHLDFLDILLGVR-----DESG----------IKLSDAELRAEV 309

  Fly   314 LLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEK-PLDYDTLMGMKYLNCVVS 377
            ..|...|.:|..:.:|:..|.:.:.||.|:....|:..:   ||:: ...:|.|..|.||...:.
  Rat   310 DTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGI---LGDQDSFQWDDLAKMTYLTMCMK 371

  Fly   378 ESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFD 442
            |..|.:||...|.|.........|..     :|....|:.:::.|||.:...:|:||.|.|.||.
  Rat   372 ECFRLYPPVPQVYRQLNKPVTFVDGR-----SLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFS 431

  Fly   443 EEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYH--LKPTD---RTPADMMSSIS 502
            .|:......|.::||..|.|:|||.:.|:.|:|.:....:||:.  |.|:.   :.|..::.|.:
  Rat   432 PENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQLILRSKN 496

  Fly   503 GFRLLPREL 511
            |..|..:.|
  Rat   497 GIHLYLKPL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 104/464 (22%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 102/457 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.