DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4f13

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_570952.1 Gene:Cyp4f13 / 170716 MGIID:2158641 Length:523 Species:Mus musculus


Alignment Length:400 Identity:92/400 - (23%)
Similarity:175/400 - (43%) Gaps:67/400 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFV----QRQLDAGTSELELKDFFT 183
            |:|..| :|...|..|||.|....::...::.:    ::|:.:    |.....|||.|::.:..:
Mouse   137 LMSAGD-KWSHHRRLLTPAFHFDILKSYVKIFN----KSVNIMHAKWQCLASKGTSRLDMFEHIS 196

  Fly   184 RYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMN 248
            ..|.|.:....|.:..|. ::.::::.:....:|..                ::|..|.|.:.::
Mouse   197 LMTLDSLQKCIFSVDSNC-QESDSKYIAAILELSSL----------------VVKRHRQPFLYLD 244

  Fly   249 NVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEA---QRQFKAEQEG--SAESAAQQDKAEFND-- 306
            .:.|   |.....::||     ..|::|...:|   :|:.....:|  ..::.|:....:|.|  
Mouse   245 LLYY---LTADGRRFRK-----ACDLVHNFTDAVIKERRSTLNTQGVEFLKAKAKTKTLDFIDVL 301

  Fly   307 -------------DDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGE 358
                         :|:.|:...|...|.:|..:.||:..|.|..:||.||:...|:..:......
Mouse   302 LMAEDEHGKGLSNEDIRAEADTFMFGGHDTTTSALSWILYNLARHPEYQERCRQEVQELLRDRDS 366

  Fly   359 KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKD----EEGEVVVNLREDDLVHIN 419
            :.:::|.|..:.:|...:.||||..||..::.|.|..|..|.|    .:|.:.|         |:
Mouse   367 EEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCTQDVLLPDGRAIPKGNICV---------IS 422

  Fly   420 VGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLR 484
            :..:||:|..:|:||.:.|.|||.|:..:.....::||..|.|:|||...|:.|:|..:...:||
Mouse   423 IFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGTRNCIGQTFAMSEIKVALALTLLR 487

  Fly   485 YHLKPTDRTP 494
            :.:.|.|:.|
Mouse   488 FRILPDDKEP 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 91/399 (23%)
Cyp4f13NP_570952.1 p450 52..513 CDD:278495 91/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.