DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP4B1

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:494 Identity:115/494 - (23%)
Similarity:192/494 - (38%) Gaps:121/494 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GVFNLRDP-----LYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQ 133
            |..|:.:|     :|...||:     ....:|.|...             |.:.||.|...:|.|
Human    90 GFLNIYEPDYAKAVYSRGDPK-----APDVYDFFLQW-------------IGRGLLVLEGPKWLQ 136

  Fly   134 MRSTLTPTF-------------TSLKIR-----------QMFELIHFCNV--EAVDFVQR----Q 168
            .|..|||.|             .|.:|.           :.|::  ||:|  .|::.:.:    :
Human   137 HRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDI--FCDVGHMALNTLMKCTFGR 199

  Fly   169 LDAGTSELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILM 233
            .|.|........::...::   .|.....::.||:..|           :|.:|         |.
Human   200 GDTGLGHSRDSSYYLAVSD---LTLLMQQRLVSFQYHN-----------DFIYW---------LT 241

  Fly   234 P---KLMKALRVPVMDMNNVDYFKKLVFGAMKYRKE-QSIVRPDMIHLLMEAQRQFKAEQEGSAE 294
            |   :.::|.:|.....:.|...:|......|.||: |:....|.:.:|:               
Human   242 PHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILL--------------- 291

  Fly   295 SAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEK 359
            .|..:|..:.:|.||.|:...|...|.:|..:.:|:..|.:.:.||.|.:...|   |:|.||::
Human   292 GARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREE---VREILGDQ 353

  Fly   360 P-LDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGAL 423
            . ..:|.|..|.||...:.||.|.:||...|.|.........|..     :|....|:.:::.||
Human   354 DFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGR-----SLPAGSLISMHIYAL 413

  Fly   424 HHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYH-- 486
            |.:...:|:||.|...||..|:..:...|.::||..|.|:|||.:.|:.|:|.:....:||:.  
Human   414 HRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFS 478

  Fly   487 LKPTDRTPADM----MSSISGFRLLPRELFWCKLESRGP 521
            |.|: |.|..|    :.|.:||.|        .|:..||
Human   479 LDPS-RLPIKMPQLVLRSKNGFHL--------HLKPLGP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 112/485 (23%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 111/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.