DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:443 Identity:112/443 - (25%)
Similarity:173/443 - (39%) Gaps:110/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLD------AGTSELE 177
            |...||.|..:.|.|.|..|||.|....::....|:       .|.|:..||      ...|.||
Human   127 IGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLM-------ADSVRVMLDKWEELLGQDSPLE 184

  Fly   178 LKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRV 242
            :....:..|.|.|...||..|.:...|.|::  |..|.||                         
Human   185 VFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQ--SYIQAIS------------------------- 222

  Fly   243 PVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEA--------------------QRQFKA 287
               |:||      |||..::....|:    |.|:.|..|                    .|:.:.
Human   223 ---DLNN------LVFSRVRNAFHQN----DTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQL 274

  Fly   288 EQEGSAESAAQQDKAEF---------------NDDDLLAQCLLFFSAGFETVATCLSFTSYELMM 337
            ::||..|...::...:|               :|.||.|:...|...|.:|.|:.:|:..|.|..
Human   275 QKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALAT 339

  Fly   338 NPEVQEKLLAEILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKD 401
            :|:.||:...||.::   ||: ..:.::.|..|.|....:.|:||.:||...:.|...:.....|
Human   340 HPKHQERCREEIHSL---LGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPD 401

  Fly   402 EEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERF---DEEHKHEIRQFTYLPFGVGQRS 463
            ..     :|.:..:|.:::..|||:|..:|.||.|.|.||   ..:|.|     .:|||..|.|:
Human   402 GR-----SLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSH-----AFLPFSGGSRN 456

  Fly   464 CIGNRLALMEVKSLIFQLVLRYHLKP-TDRTPAD----MMSSISGFRLLPREL 511
            |||.:.|:.|:|......:||:.|.| ..|.|..    ::.|.:|..|..|.|
Human   457 CIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 112/443 (25%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 109/437 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.