DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:414 Identity:99/414 - (23%)
Similarity:172/414 - (41%) Gaps:51/414 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFT 183
            |.|.||.|...:|.|.|..|||.|....::....:.    .|:...:..:.:...||.:..|.|.
Mouse   122 IGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIF----AESTRVMLDKWEKKASENKSFDIFC 182

  Fly   184 ---RYTNDVIATAAFGIQVNSFKDPNNEFF--------SIGQRISEFTFWGGLKVMLYILMPKLM 237
               ....|.:....||...:.....:|.::        .:.|||..|.:...   .:|.|.|...
Mouse   183 DVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHND---FIYWLTPHGR 244

  Fly   238 KALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRP----DMIHLLMEAQRQFKAEQEGSAESAAQ 298
            :.||...:..::.|:..:....|::..|||..::.    |.:.:|:.|:     ::.|       
Mouse   245 RFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGAR-----DESG------- 297

  Fly   299 QDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEK-PLD 362
               .:.:|.||.|:...|...|.:|..:.:|:..|.:.:.|..|::...|   |:|.||:: ...
Mouse   298 ---IKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREE---VREILGDRDSFQ 356

  Fly   363 YDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDP 427
            :|.|..|.||...:.|..|.:||...|.|.........|..     :|....|:.:::.|||.:.
Mouse   357 WDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGR-----SLPAGSLISLHIYALHRNS 416

  Fly   428 DNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTD- 491
            ..:|:||.|.|.||..|:......|.::||..|.|:|||.:.|:.|:|.:....:||:...|.. 
Mouse   417 AVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDPS 481

  Fly   492 ----RTPADMMSSISGFRLLPREL 511
                :.|..::.|.:|..|..:.|
Mouse   482 KIPIKVPQLILRSKNGIHLYLKPL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 99/414 (24%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 97/407 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.