DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:479 Identity:115/479 - (24%)
Similarity:195/479 - (40%) Gaps:107/479 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPT 141
            |:|..||   ||:.::.| :...|.   ...||.:.|  ...|...||.|..::|.|.|..|||.
Mouse    91 NIRVLLY---DPDYVKVV-LGRSDP---KASGIYQFF--APWIGYGLLLLNGKKWFQHRRMLTPA 146

  Fly   142 FTSLKIRQMFELIHFCNVEAVDFV---QRQLDAGTSELELKDFFTRYTNDVIATAAFGIQVNSFK 203
            |....::...:::    .::|:.:   ..:||.....||:....:..|.|.:...||..|.:...
Mouse   147 FHYDILKPYVKIM----ADSVNIMLDKWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQL 207

  Fly   204 DPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFK--------KLVF-- 258
            |.|::.::                          ||    |.|:||:.:|:        .:::  
Mouse   208 DENSKLYT--------------------------KA----VEDLNNLTFFRLRNAFYKYNIIYNM 242

  Fly   259 -------------------GAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAE------SAAQ 298
                               |.:|.||.|          |...:...||.::...:      .|..
Mouse   243 SSDGRLSHHACQIAHEHTDGVIKMRKSQ----------LQNEEELQKARKKRHLDFLDILLFARM 297

  Fly   299 QDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGE-KPLD 362
            :|:...:|:||.|:...|...|.:|.|:.:|:..|.|..:||.|::...|:.::   ||: ..:.
Mouse   298 EDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSI---LGDGTSVT 359

  Fly   363 YDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDP 427
            :|.|..|.|....:.|:||.:||...|.|...|.....|..     ::.:.....|::..|||:|
Mouse   360 WDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGR-----SIPKGITATISIYGLHHNP 419

  Fly   428 DNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKP-TD 491
            ..:|.|:.|.|.||..:..|  ....||||..|.|:|||.:.|:.|:|..:...:||:.|.| ..
Mouse   420 RFWPNPKVFDPSRFAPDSSH--HSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPDPT 482

  Fly   492 RTPAD----MMSSISGFRLLPREL 511
            |.|..    ::.|.:|..|..::|
Mouse   483 RIPVPIARLVLKSKNGIHLCLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 115/479 (24%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 113/472 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.