DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:433 Identity:108/433 - (24%)
Similarity:177/433 - (40%) Gaps:90/433 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTF--TSLK--IRQMFELIHFCNVEAVDFVQRQLDAGTSELELK 179
            |...||.|..:.|.|.|..|||.|  ..||  ::.|.:.|..    .:|..:|..|..:| :|:.
Mouse   126 IGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRL----MLDKWERLADQDSS-IEIF 185

  Fly   180 DFFTRYTNDVIATAAF----GIQVN--------SFKDPNNEFFSIGQRISEFTFWGGLKVMLYIL 232
            ...:..|.|.:...||    .:||:        :..|.||.|.|..:.|..      ....:|.|
Mouse   186 QHISLMTLDTVMKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFH------QNDTIYKL 244

  Fly   233 MPKLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAA 297
            ......|.:...:..::.|       |.:|.||:|                   .:.||..|...
Mouse   245 SSNGRLAKQACQLAHDHTD-------GVIKLRKDQ-------------------LQDEGELEKIK 283

  Fly   298 QQDKAEF---------------NDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLA 347
            ::.:.:|               :|.||.|:...|...|.:|.|:.:|:..|.|..:|:.|::...
Mouse   284 KKRRLDFLDILLFARMENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCRE 348

  Fly   348 EILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLR 411
            |   |:..||: ..:.:|.|..:.|....:.|:||.:||...:.|...:.....|..     :|.
Mouse   349 E---VQSLLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGR-----SLP 405

  Fly   412 EDDLVHINVGALHHDPDNFPEPEQFRPERF---DEEHKHEIRQFTYLPFGVGQRSCIGNRLALME 473
            :...|.:::..|||:|..:|.||.|.|.||   ...|.|     ::|||..|.|:|||.:.|:.|
Mouse   406 KGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRHSH-----SFLPFSGGARNCIGKQFAMSE 465

  Fly   474 VKSLIFQLVLRYHLKP-TDRTPADM----MSSISGFRLLPREL 511
            :|.::...:||:.|.| ..|.|..:    :.|.:|..|..::|
Mouse   466 LKVIVALTLLRFELLPDPTRVPMPLARLVLKSKNGIYLHLKKL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 108/433 (25%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 106/426 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.