DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP4F22

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:438 Identity:96/438 - (21%)
Similarity:189/438 - (43%) Gaps:83/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQ---RQLDAGTS-ELELK 179
            :...||..:..:|.:.|..|||.|....::...::.:    ::.|.:.   |.|..|:: .|::.
Human   140 LGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFN----QSADIMHAKWRHLAEGSAVSLDMF 200

  Fly   180 DFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPV 244
            :..:..|.|.:....|....|           ..:::|::             :..:::...:.|
Human   201 EHISLMTLDSLQKCVFSYNSN-----------CQEKMSDY-------------ISAIIELSALSV 241

  Fly   245 MDMNNVDYFKKLVF--GAMKYRKEQSIVRPDMIH-----LLMEAQRQFKAEQEGSAES------- 295
            .....:.::...::  .|...|..|:.   ||:|     ::.|.:|..:  |:| ||:       
Human   242 RRQYRLHHYLDFIYYRSADGRRFRQAC---DMVHHFTTEVIQERRRALR--QQG-AEAWLKAKQG 300

  Fly   296 -----------AAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEI 349
                       |..:|..|.:|:|:.|:...|...|.:|.::.:|:..:.|...||.|||...||
Human   301 KTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEI 365

  Fly   350 LAVKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDD 414
            ..|.:....:.|::|.|..:.:....:.||||::||..:|.|.|..|.:|.|  |.::   .:..
Human   366 QEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPD--GRII---PKGI 425

  Fly   415 LVHINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIF 479
            :..:::...||:|..:|:.:.:.|.|||.::..:.....|:||..|.|:|||...|:.|::.::.
Human   426 ICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVA 490

  Fly   480 QLVLRYHLKPTDRT------PADMMSSISGFRLLPRELFWCKLESRGP 521
            ..:||:.|. .|||      |..::.:.:|        .|.|:|...|
Human   491 LTLLRFRLS-VDRTRKVRRKPELILRTENG--------LWLKVEPLPP 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 92/429 (21%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 93/431 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.