DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and COQ8

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_011396.1 Gene:COQ8 / 852758 SGDID:S000003087 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:372 Identity:89/372 - (23%)
Similarity:161/372 - (43%) Gaps:48/372 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRRVLGYGVVGAGLASAGWSLHTNDYDPNSLGIVRLSRSAAAVVDVALTYKRELYYKEWDKETPE 67
            :.|:..||.:.||                    |.::.:|..:.:||            ...:|.
Yeast    75 ISRLFHYGSLAAG--------------------VGMNAAAKGISEVA------------KGNSPT 107

  Fly    68 YKA---EKSRVHKIAAEKLLQLICINKGVYIKVGQHIGAL-EYLLPKEFVQTMKVLHSDAPQNPI 128
            :|:   ..|.:.:| ..|..::    :||.:|:||.:... |.:||||..:.:..:.:.|...|.
Yeast   108 WKSLILSDSNIDRI-TNKFSKM----RGVALKIGQLLSFQDEKVLPKELYEILSRVQNSANHMPQ 167

  Fly   129 EDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMKT 193
            ..|.||:.::|..|.:..|..|::.|:..||:.|||.|.|.:|:.|.||:|:|.||.:...|:.:
Yeast   168 RQLEKVMAKELGANWKTKFSKFDKIPMAAASIGQVHAAELPSGQRVVVKIQYPGVKESIDSDLNS 232

  Fly   194 MELAVNVLARIFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSS 258
            :.:.:...:.:.....:...:..::..|..|.|:..|.|..:|.....|......||.::.:|::
Yeast   233 LLMLLTASSLLPKGLFLDKTIANARTELKWECDYNREARALQKFEALLKDDPAFEVPHVFPEYTT 297

  Fly   259 SRVLVMEYLEGGHVTDLDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVR-RTPE 322
            ..::.|..:||..:..|.  :.::.....::..|.:|..|.|....::.:||:..|.|.. ||. 
Yeast   298 DNIITMTRMEGTEIMKLP--KASQETKNFISENIMRLCLEEIATFKYMQTDPNWANFLYNGRTK- 359

  Fly   323 NSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQLG 369
               :|.|||.|......:.|...|..|.......|||...:.|.|||
Yeast   360 ---KIELLDFGASRPFAEDFILKYRKLLTYATLRDRKGAYEMSVQLG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 63/251 (25%)
COQ8NP_011396.1 ABC1_ADCK3 153..403 CDD:270872 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.