DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and AT1G61640

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_176358.2 Gene:AT1G61640 / 842460 AraportID:AT1G61640 Length:621 Species:Arabidopsis thaliana


Alignment Length:303 Identity:86/303 - (28%)
Similarity:135/303 - (44%) Gaps:43/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTA 158
            :||.||.|........|:....:..|||:||::......|.|.........|||:.|:..|:.:.
plant   224 FIKFGQWIATRPDRFNKDLCLQLSKLHSNAPEHSFAFTKKSIENAFGRKLSEIFEEFDEAPVASG 288

  Fly   159 SLAQVHKARLK---TGEL-----VAVKVQHPYVKGNSRVDMKTMELAVNVLARI---FPDFKIHW 212
            |:||||:|.||   .|:.     |||||:||.|:...:.|.    :.:|.:||:   .|.  ::|
plant   289 SIAQVHRASLKFQYAGQKVKSSEVAVKVRHPCVEETMKRDF----VIINFVARLTTFIPG--LNW 347

  Fly   213 L-----VEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHV 272
            |     |::....:..::|...|..:..:....|:.:..:..||..:......|||..|..|..|
plant   348 LRLDECVQQFSVYMLSQVDLSREASHLSRFIYNFRGWKDVSFPKPIYPLIHPAVLVETYEHGESV 412

  Fly   273 TDLDYI----RRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSL-------- 325
            .  .|:    .:.|:.: .||:.......:|:....|:|:|.||||||||  |.|:.        
plant   413 A--RYVDGSEGQEKLKA-KVAHIGTNALLKMLLVDNFIHADMHPGNILVR--PNNTRRGLFRSRK 472

  Fly   326 -EIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQ 367
             .||.||.|:.|.|:   :.|..||......|.|:..|..:|:
plant   473 PHIVFLDVGMTAELS---KTDRDNLLGFFKAVARRDGRTAAER 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 80/279 (29%)
AT1G61640NP_176358.2 ADCK2-like 248..539 CDD:270873 80/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.