DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and ATH13

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_201299.2 Gene:ATH13 / 836618 AraportID:AT5G64940 Length:761 Species:Arabidopsis thaliana


Alignment Length:342 Identity:106/342 - (30%)
Similarity:168/342 - (49%) Gaps:33/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ELYYKEW-DKETPEYK---AEKSRV--HKIAAEKLLQLICINKGVYIKVGQHIGALEYLLPKEFV 113
            :..::.| ..:...||   .|:.:|  .|:.|:.|.:.|......:||:||.......:||:|:|
plant   188 QFIFRTWLSNKKFSYKGGMTEEKKVLRRKVLAKWLKENILRLGPTFIKIGQQFSTRVDILPQEYV 252

  Fly   114 QTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKV 178
            ..:..|....|..|......::.::|..:.|:|||.|:.||:..|||.|||:|||| |:.|.:||
plant   253 DQLSELQDQVPPFPSATALSIVEEELGGSVEDIFDRFDYEPIAAASLGQVHRARLK-GQEVVLKV 316

  Fly   179 QHPYVKGNSRVDMKTMELAVNVLARIFP---DFKIHW--LVEESKKNLPIELDFLNEGRNAEKVA 238
            |.|.:|....:|:|.:.:....|.::.|   ..|..|  :.:|....|..|:|:..|..|:|..|
plant   317 QRPGLKDLFDIDLKNLRVIAEYLQKVDPKSDGAKRDWVAIYDECASVLYQEIDYTKEAANSELFA 381

  Fly   239 KQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVTDLDYIRRNKI---DSFAV-ANRIG----QL 295
            ..||...:::||.|||:|::.:||.|||:.|        |:.|||   |...| ..|:|    :.
plant   382 NNFKDLEYVKVPSIYWEYTTPQVLTMEYVPG--------IKINKIQALDQLGVDRKRLGRYAVES 438

  Fly   296 YSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKA 360
            |.|.|...||.|:|||||||.|  ...|...::..|.|:..:::...|......:..:.:.|...
plant   439 YLEQILSHGFFHADPHPGNIAV--DDVNGGRLIFYDFGMMGSISPNIREGLLEAFYGVYEKDPDK 501

  Fly   361 MRQHSEQLGI---KGDL 374
            :.|...|:|:   .|||
plant   502 VLQAMVQMGVLVPTGDL 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 85/263 (32%)
ATH13NP_201299.2 AarF 178..719 CDD:223733 106/342 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D790106at2759
OrthoFinder 1 1.000 - - FOG0000919
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.