DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and AT5G50330

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_199844.3 Gene:AT5G50330 / 835099 AraportID:AT5G50330 Length:479 Species:Arabidopsis thaliana


Alignment Length:451 Identity:120/451 - (26%)
Similarity:211/451 - (46%) Gaps:76/451 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WSLHTNDYDPNSLGIVRLSRSAAAVVDVALTYKRELYYKEWDKETPEYKAEKSRVHKIAAEKLLQ 85
            |...||.|....:..:|:|    .|.|..   |:|   :.|:::           |:.||:|:..
plant    27 WVRATNIYTGYKVFQLRVS----LVKDAK---KQE---EMWERQ-----------HEQAADKIYF 70

  Fly    86 LICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSF 150
            :.....|.::|:.|.: |...:.|..:|:.:..|...||..|.:.:..|:.::|..:..|||::|
plant    71 MCSDLGGFFLKIAQLL-AKPDMAPAAWVKKLVTLCDQAPATPFDAIQLVLEKELGKSIGEIFETF 134

  Fly   151 EREPLGTASLAQVHKARLKTGEL-VAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPDFKIHWLV 214
            :.:|||:||:||||:|.:|..:: |.||||||.::.....|::.::|....:.|....|.:|.:.
plant   135 DEKPLGSASIAQVHRAIVKGNKMNVVVKVQHPGIERLMMTDIRNLQLFALYMQRTDIKFDLHSIT 199

  Fly   215 EESKKNLPIELDFLNEGRNAEKV---AKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVTDL- 275
            :|.:|.:..|.||..|....|::   ..:..|.|.:.||::.....:.|||||||:.|..:..: 
plant   200 KEMEKQIGYEFDFKREANAMERIRCFLYENNKKSPVLVPRVLRDMVTKRVLVMEYINGIPILSIG 264

  Fly   276 DYIRRNKIDSFA---------VANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLD 331
            |.:.:..|:...         :.|.:.:.|.:||.::||.|:||||||||:.:    ..|:.|||
plant   265 DEMAKRGINPHGKIAEAAKHNILNSLSRAYGQMILKSGFFHADPHPGNILICK----GQEVALLD 325

  Fly   332 HGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQLGIKGDLYGLFACMVTGRPWETVMQGLTK 396
            :|....|.:|.|..|:||.:::  .|..|.|                   |:...||..:..:.|
plant   326 YGQVKELPNKLRLGYANLVIAM--ADNNASR-------------------VSQSFWEMGLHTVAK 369

  Fly   397 VKYSKEEK--------NTLQNNTSLVLPHISD-------VLEQVDRQMLLILKTNDLIRGI 442
            .:..::|.        :|.......||...||       .:|....::..:|:|..|:||:
plant   370 CENEQQELLRLAQTLFDTKMPTGQTVLQPFSDDSSIKKIAVETFPEELFSVLRTVVLLRGL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 83/264 (31%)
AT5G50330NP_199844.3 ABC1_ADCK3-like 103..359 CDD:270691 84/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D790106at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.