DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and AT5G24970

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001190389.1 Gene:AT5G24970 / 832567 AraportID:AT5G24970 Length:761 Species:Arabidopsis thaliana


Alignment Length:475 Identity:120/475 - (25%)
Similarity:203/475 - (42%) Gaps:89/475 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLRRV--LGYGVVGAGLASAGW------SLHT------NDYDPNSLGIVR-----LSRSAAAVVD 47
            |.||.  .|:..|..|:.:|.:      ||.|      ..|...|...|.     |:...||::.
plant    92 LQRRAYSTGFTSVHGGIPTAEYAKLRRESLETEFGHALGAYSSKSFSAVYRFGPFLALYRAAIIS 156

  Fly    48 ---VALTYKRELYYKEWDKETPEYKAEKSRVHKIAAEKLLQLICINKGVYIKVGQHIGALEYLLP 109
               |.|.: .:|:.::..|...:::           |.|:.|    ...|||:||.:.....:||
plant   157 YHVVKLAF-WQLFVQDMRKRAVKFR-----------ETLISL----GPFYIKLGQALSTRPDILP 205

  Fly   110 KEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELV 174
            ..:.|.:..|....|..|.....:.|.:.|.....::|.....:|:..|||.||:||.|.:|:||
plant   206 SIYCQELSKLQDQIPPFPTTVAMRCIEEQLGAPVSKLFADISLKPVAAASLGQVYKAHLHSGQLV 270

  Fly   175 AVKVQHPYVKGNSRV---DMKTMELAVNVLARIFPDFK-IHWLVEESKKNLPIELDFLNEGRNAE 235
            |||||.|   |.|.:   |....::....|.|.....| :...|.|..:::..|:|::.|.:|||
plant   271 AVKVQRP---GMSLILTRDALLFKMIGGQLKRFAKARKDLLVAVNEMVRHMFDEIDYVLEAKNAE 332

  Fly   236 KVAKQFKKYSW------------------------LRVPKIYWKYSSSRVLVMEYLEGGHVTDLD 276
            :.|   ..||:                        ::||||||.::.:.||.||:::|..:||..
plant   333 RFA---SLYSFDSGNEQIDDNAGPRNMSRNHRAENIKVPKIYWNFTRTAVLTMEWIDGIKLTDEI 394

  Fly   277 YIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHGLYANLTDK 341
            .::|..:|...:.::......:.:...||.|:||||||::.  |.|.||  |..|.|:..|:...
plant   395 KLKRASLDRRDLIDQGLSCSLKQLLEVGFFHADPHPGNLVA--TKEGSL--VYFDFGMMGNIPRH 455

  Fly   342 FRYDYSNLWLSILKVDRKAMRQHSEQLGI--KG-DLYGLFACMVT--------GRPWETVMQGLT 395
            :|.....:.:..:..|..::......||.  :| |:..:...:.|        .:.::.||:.|.
plant   456 YRVGLIQILVHFVNRDSLSLANDFLSLGFLPEGVDIQAVSNALRTSFGSTTRISQDFQGVMEQLY 520

  Fly   396 KVKYSKEEKNTLQNNTSLVL 415
            .|.|  |...:|..:.:||:
plant   521 DVMY--EFNFSLPPDYALVI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 75/278 (27%)
AT5G24970NP_001190389.1 UbiB 141..565 CDD:273909 107/426 (25%)
ABC1_ADCK3-like 214..479 CDD:270691 75/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000919
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.