DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and AT5G24810

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001190388.1 Gene:AT5G24810 / 832550 AraportID:AT5G24810 Length:1040 Species:Arabidopsis thaliana


Alignment Length:481 Identity:117/481 - (24%)
Similarity:216/481 - (44%) Gaps:75/481 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SLGIVRLSRSAAAVVDVA----LTYKRELYYKEWDKETPEYKAEKSRVHKIAAEKLLQLICINKG 92
            |:|:..:.|....|..:|    |.||.....::|.|:: :..|...:.|...|:::|.||...:|
plant    47 SMGLGNIYRRRMKVFSIAILIYLDYKGVQQKEKWIKKS-KVPALWDKAHDRNAKRVLNLIVELEG 110

  Fly    93 VYIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKV----------------------- 134
            :::|:||::.....:||:.::..:..|....|..|::::.|:                       
plant   111 LWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCKIYLNVNIRGYTKKEKYFFDIMSMW 175

  Fly   135 --------IRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDM 191
                    |.::|..:.:.:|..|..|||.|||:||||:|.|..|:.|.|||||..::.....|:
plant   176 YDFKVCRTIERELGNSMDVLFTDFVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDL 240

  Fly   192 KTMELAVNVLARIFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQF---KKYSWLR----- 248
            |..:..|:.:|...|.:..:.:::|..|..|.||||..|..|...|:...   |....:|     
plant   241 KNAKSIVDWIAWAEPQYNFNPMIDEWCKEAPRELDFNIEAENTRTVSGNLGCKKTNDEVRSANRV 305

  Fly   249 ---VPKIYWKYSSSRVLVMEYLEGGHVTDLDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDP 310
               :|.|.  .||..||::||::|..:.|::.:....:|...:...|.:.|:..||..||.:.||
plant   306 DVLIPDII--QSSESVLILEYMDGVRLNDVESLDAFGVDKQKIVEEITRAYAHQIFVDGFFNGDP 368

  Fly   311 HPGNILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQLGIK---- 371
            ||||.||.:.|::  ..:|||.||...::...:...:.::|:..:.|:.|:.....::|:|    
plant   369 HPGNFLVSKEPQH--RPILLDFGLSKKISHSLKQALAKMFLASAEGDQVALLSAFAEMGLKLRLD 431

  Fly   372 -----GDLYGLFACMVTGRPWETVM--------QGLTKVKYSKEEKNTLQNNTSLVLPHISDVLE 423
                 ..:.|||  ..:..|....|        |.:..:|..:|:....|.......|     ::
plant   432 MPDQAMSVAGLF--FRSSTPSSEAMKTFKTLNDQRVQNMKVIQEKMQLNQKEVKRFNP-----ID 489

  Fly   424 QVDRQMLLILKTNDLIRGIESTLRTQ 449
            .....:::..:..:|:||:.||:..:
plant   490 AFPGDIVIFARVINLLRGLSSTMNVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 78/292 (27%)
AT5G24810NP_001190388.1 AarF 44..536 CDD:223733 117/481 (24%)
ABC1_ADCK3-like 136..421 CDD:270691 78/288 (27%)
Beta-lactamase 558..>846 CDD:278569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D790106at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.