DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and ACDO1

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_194867.2 Gene:ACDO1 / 829266 AraportID:AT4G31390 Length:682 Species:Arabidopsis thaliana


Alignment Length:333 Identity:94/333 - (28%)
Similarity:148/333 - (44%) Gaps:36/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YDPNSLGIVRLSRSAAAVVD-----VALTYKRELYYKEWDKETPEYKAEK-SRVHKIAAEKLLQL 86
            |.|.::. .::..|..|||.     |.:.:...||   |...|.::...: ..|....|.:|..|
plant   113 YSPETVR-SKVLESRGAVVSLVSRGVEIVWTLGLY---WSTLTYDFLVGRDEEVVPFRARQLRNL 173

  Fly    87 ICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFE 151
            :|.....:||.||.:.....::.::::..:.:|..|.|..|.|..:.:|.::|....|.||....
plant   174 LCNLGPSFIKAGQVLANRPDIIREDYMNELCILQDDVPPFPNEVAFNIIEEELGQPLENIFSKIS 238

  Fly   152 REPLGTASLAQVHKARLK-TGELVAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPDFKIHWL-- 213
            .:.:..|||.||::|.|: |||.||:|||.|.::.....|:    .....||.....|.:..|  
plant   239 SQTIAAASLGQVYRATLRATGEDVAIKVQRPQIEPIIYRDL----FLFRTLASFLNGFSLQKLGC 299

  Fly   214 -----VEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVT 273
                 |:|..:.|..|||:..|.||.|...:.||....:::|.:|......||||||:::|...|
plant   300 NAELIVDEFGEKLLEELDYTLEARNIEDFLENFKDDPTVKIPGVYKNLCGPRVLVMEWIDGIRCT 364

  Fly   274 DLDYIRRNKID-----SFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHG 333
            |...|:...||     :..|:..:.||     ...|..|.|||||||...:..    .|..:|.|
plant   365 DPQAIKDAGIDLNGFLTVGVSAALRQL-----LEFGLFHGDPHPGNIFAMQDG----RIAYVDFG 420

  Fly   334 LYANLTDK 341
            ..|.|:.:
plant   421 NVAVLSQQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 74/237 (31%)
ACDO1NP_194867.2 AarF 166..593 CDD:223733 82/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D790106at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.