DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and COQ8B

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_079152.3 Gene:COQ8B / 79934 HGNCID:19041 Length:544 Species:Homo sapiens


Alignment Length:362 Identity:89/362 - (24%)
Similarity:166/362 - (45%) Gaps:48/362 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AEKLLQLICINKGVYIKVGQHIGALE--YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCN 142
            ||:::|.:|..:|..:||||.:...:  ::.| :.....:.:...|...|...:.:|:.::|..:
Human   139 AERIVQTLCTVRGAALKVGQMLSIQDNSFISP-QLQHIFERVRQSADFMPRWQMLRVLEEELGRD 202

  Fly   143 PEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMK----TMELAVNVLAR 203
            .:....|.|..|...||:.|||:..|:.|..||||:|:|.:..:.:.|::    .::::..:.|.
Human   203 WQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAG 267

  Fly   204 IFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLE 268
            :|.:..:..|.:|    |..|.|:..|...|:...:......:.|||.:..:..::|||.|| |.
Human   268 LFAEQSLQALQQE----LAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGME-LA 327

  Fly   269 GGHVTD----LDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVL 329
            ||...|    |....||:|     ..::..|....:|...|:.:||:..|.|.   ..:|.::.|
Human   328 GGVPLDQCQGLSQDLRNQI-----CFQLLTLCLRELFEFRFMQTDPNWANFLY---DASSHQVTL 384

  Fly   330 LDHGLYANLTDKFRYDYSNLWLSILKV----DRKAMRQHSEQL----GIKGDLYG---LFACMVT 383
            ||.|    .:.:|..::::.::.::|.    ||..:.|.|..|    |.:...:.   :.|.|:.
Human   385 LDFG----ASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMIL 445

  Fly   384 GRPWETVMQGLTKVKY---SKEEKNTLQNNTSLVLPH 417
            |.|:.|  ||    .|   |.|....:|:...::|.|
Human   446 GEPFAT--QG----PYDFGSGETARRIQDLIPVLLRH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 65/266 (24%)
COQ8BNP_079152.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..86
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 155..158 2/2 (100%)
ABC1_ADCK3 175..424 CDD:270872 64/265 (24%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 216..219 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.