DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and Coq8a

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001156762.1 Gene:Coq8a / 67426 MGIID:1914676 Length:645 Species:Mus musculus


Alignment Length:300 Identity:74/300 - (24%)
Similarity:144/300 - (48%) Gaps:26/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AEKLLQLICINKGVYIKVGQHIGALE--YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCN 142
            ||:::..:|..:|..:|:||.:...:  ::.| ...:..:.:...|...|::.:.|.:..||..:
Mouse   257 AERIVSTLCKVRGAALKLGQMLSIQDDAFINP-HLAKIFERVRQSADFMPLKQMTKTLNSDLGPH 320

  Fly   143 PEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPD 207
            ..:..:.||..|...||:.|||.||:|.|..||:|:|:|.|..:...|:..: :||..::.:.|:
Mouse   321 WRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNL-MAVLNMSNMLPE 384

  Fly   208 --FKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEG- 269
              |..| |::..::.|.:|.|:..|...|:|..:..|.:.:..||:|..:..|..||..|.:.| 
Mouse   385 GLFPEH-LIDVLRRELTLECDYQREAAYAKKFRELLKDHPFFYVPEIVDELCSPHVLTTELISGF 448

  Fly   270 --GHVTDLDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDH 332
              .....|....||:|     ...|..|....:|....:.:||:..|...  .|:.. ::.|||.
Mouse   449 PLDQAEGLSQEVRNEI-----CYNILVLCLRELFEFHVMQTDPNWSNFFY--DPQQH-KVALLDF 505

  Fly   333 GLYANLTDKFRYDYSNLWLSILKV----DRKAMRQHSEQL 368
            |    .|.::...:::|::.:::.    ||:|:.:.|.::
Mouse   506 G----ATREYDRSFTDLYIQVIRAAADQDREAVLKKSIEM 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 66/259 (25%)
Coq8aNP_001156762.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 273..276 1/2 (50%)
ABC1_ADCK3 292..542 CDD:270872 66/263 (25%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 334..337 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.