DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and COQ8A

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_064632.2 Gene:COQ8A / 56997 HGNCID:16812 Length:647 Species:Homo sapiens


Alignment Length:481 Identity:110/481 - (22%)
Similarity:199/481 - (41%) Gaps:85/481 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVRLSRSAAAVVDVALTYKRELYYKEWDKETPEYK----AEKSRVHKIAAEKLLQLICINKGVYI 95
            |.||:......|.:......|:..|....|.|..|    .....:.:..||::::.:|..:|..:
Human   211 IGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAAL 275

  Fly    96 KVGQHIGALE--YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTA 158
            |:||.:...:  ::.| ...:..:.:...|...|::.:.|.:..||..|..:..:.||..|...|
Human   276 KLGQMLSIQDDAFINP-HLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAA 339

  Fly   159 SLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMKTMELAVNVLARIFPD--FKIHWLVEESKKNL 221
            |:.|||.||:|.|..||:|:|:|.|..:...|:..: :||..::.:.|:  |..| |::..::.|
Human   340 SIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNL-MAVLNMSNMLPEGLFPEH-LIDVLRREL 402

  Fly   222 PIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEG---GHVTDLDYIRRNKI 283
            .:|.|:..|...|.|.....|.:.:..||:|..:..|..||..|.:.|   .....|....||:|
Human   403 ALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEI 467

  Fly   284 DSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSN 348
                 ...|..|....:|...|:.:||:..|...  .|:.. ::.|||.|    .|.::...:::
Human   468 -----CYNILVLCLRELFEFHFMQTDPNWSNFFY--DPQQH-KVALLDFG----ATREYDRSFTD 520

  Fly   349 LWLSILKV----DRKAMRQHS--------EQLGIKGDLYGLFACMVTG------RPWETVMQGLT 395
            |::.|::.    ||:.:|..|        .::.:..|.: |.|.::.|      .|::...|..|
Human   521 LYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAH-LDAILILGEAFASDEPFDFGTQSTT 584

  Fly   396 KVKYSKEEKNTLQNNTSLVLPHISDVLEQVDRQMLLILKTNDLIRGIESTLRTQNRM-TAFWVMS 459
                   ||  :.|...::|.|                   .|:...|.|.....:| .:|.:.|
Human   585 -------EK--IHNLIPVMLRH-------------------RLVPPPEETYSLHRKMGGSFLICS 621

  Fly   460 KC-----C------VQSSYAEQRAKQ 474
            |.     |      ..|:|.:::|:|
Human   622 KLKARFPCKAMFEEAYSNYCKRQAQQ 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 69/267 (26%)
COQ8ANP_064632.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..203
KxGQ motif. /evidence=ECO:0000269|PubMed:25498144 276..279 1/2 (50%)
ABC1_ADCK3 295..545 CDD:270872 69/263 (26%)
AAAS motif. /evidence=ECO:0000269|PubMed:25498144 337..340 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.