DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and coq8aa

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001002728.2 Gene:coq8aa / 437001 ZFINID:ZDB-GENE-040718-487 Length:619 Species:Danio rerio


Alignment Length:374 Identity:87/374 - (23%)
Similarity:165/374 - (44%) Gaps:61/374 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRRVLGYG--VVGAGLAS----AGWSLHTNDYDPNSLGIVRLSRSAAAVVDVALTYKRELYYKEW 61
            |.|:..:|  .||.|:.:    |..||.:.|.:.|.          .||:|              
Zfish   179 LGRLANFGGLAVGLGIGALAEVAKKSLRSEDKNGNK----------KAVLD-------------- 219

  Fly    62 DKETPEYKAEKSRVHKIAAEKLLQLICINKGVYIKVGQHIGALE--YLLPKEFVQTMKVLHSDAP 124
               :..:.:|.:      ||::::.:|..:|..:|:||.:...:  ::.| :..:..:.:...|.
Zfish   220 ---SSPFLSEAN------AERIVRTLCKVRGAALKLGQMLSIQDDAFINP-QLAKIFERVRQSAD 274

  Fly   125 QNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRV 189
            ..||:.:.|.:..||..|..:..:.||..|...||:.|||.||:|.|..||:|:|:|.|..:...
Zfish   275 FMPIKQMTKALSNDLGPNWRDKLEMFEERPFAAASIGQVHLARMKDGREVAMKIQYPGVAQSINS 339

  Fly   190 DMKTMELAVNVLARIFPD--FKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKI 252
            |:..: :.|..::...|:  |..| |::..::.|.:|.|::.|.:.|.|..:..|.:.:..||.:
Zfish   340 DVNNL-MTVLSMSNALPEGLFPEH-LIDVMRRELALECDYIREAKCARKFKELLKDHPFFYVPDV 402

  Fly   253 YWKYSSSRVLVMEYLEGGHVTDLDYIR---RNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGN 314
            ..:.||..||..|.:.|..:...:.:.   :|:|     ...|..|....:|...::.:||:..|
Zfish   403 ISELSSQHVLTTELVPGFPLDQAEALTQELKNEI-----CKNILNLCLRELFEFRYMQTDPNWSN 462

  Fly   315 ILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQ 363
            ...  .|:.. .:.|||.|    .|..|...::::::.|:|......|:
Zfish   463 FFY--DPQTH-RVALLDFG----ATRGFDESFTDVYIEIIKAAADGNRE 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 64/251 (25%)
coq8aaNP_001002728.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..171
AarF 172..603 CDD:223733 87/374 (23%)
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 245..248 1/2 (50%)
ABC1_ADCK3 264..514 CDD:270872 64/255 (25%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 306..309 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.