DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and CG32650

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster


Alignment Length:186 Identity:43/186 - (23%)
Similarity:69/186 - (37%) Gaps:51/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 WLSILKVDRKAMRQHSE--QLGIKGDLYGLFACMVTGRPWETVMQGLTKVKYSKEEKNTLQNNTS 412
            |: |:...|:|..:..:  .|.|:..|..|..|...||...:.:..|.: :.:||.....|::..
  Fly   102 WM-IMHGSREAALRELQWNNLRIRRQLADLVRCSELGRARISALDRLFQ-RQTKELVGCRQDHER 164

  Fly   413 LVLPHISDVLE--------QVDRQML-----LILKTNDLIRGIESTL-RTQNRMTAFWVMSKCCV 463
            ::..|::..||        :..|.:.     |......|....:..| |||:|:           
  Fly   165 VLSFHLTKQLEAGKCLQRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSRL----------- 218

  Fly   464 QSSYAEQRAKQSDS---------GSSRILWLRVRERWELFKLNCYYLYLGLINFGF 510
              .|||.:.:..|.         ||:|.|..|||:           |.|||...||
  Fly   219 --EYAEIKRQALDEMTVAHEMCLGSTRSLLARVRD-----------LELGLAPLGF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 4/20 (20%)
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 37/176 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.