DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and Coq8b

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001012065.1 Gene:Coq8b / 308453 RGDID:1311356 Length:528 Species:Rattus norvegicus


Alignment Length:396 Identity:96/396 - (24%)
Similarity:178/396 - (44%) Gaps:50/396 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVRLSRSAAAVVDVALTYKRELYYKEWDKETPEYKAEKSRVHKIAAEKLLQLICINKGVYIKVGQ 99
            |.||:......|.:.|....|:..|.....:.:::.....:.:..||:::|.:|..:|..:|:||
  Rat    90 ISRLASFGGLAVGLGLGALAEVTKKSLPGGSLQHEGSSPFLTEANAERIVQTLCTVRGAALKIGQ 154

  Fly   100 HIGALE-YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQV 163
            .:...: .|:..:..:..:.:...|...|...:.||:.::|..:.::...|.|..|...||:.||
  Rat   155 MLSIQDNSLISPQLQRVFERVRQSADFMPRWQMMKVLEEELGKDWQDKVASLEEVPFAAASIGQV 219

  Fly   164 HKARLKTGELVAVKVQHPYVKGNSRVDMKT----MELAVNVLARIFPDFKIHWLVEESKKNLPIE 224
            |:..||.|..||||:|:|.|..:.:.|::.    ::::|.:...:|.:..:..|.:|    |..|
  Rat   220 HQGVLKDGTEVAVKIQYPGVAESIQSDVQNLLALLKMSVGLPEGLFAEQSLQTLQQE----LAWE 280

  Fly   225 LDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVTD----LDYIRRNKIDS 285
            .|:..|...|:...|......:.|||.:..:..::|||.|| |.||...|    |....||:|  
  Rat   281 CDYRREAACAQTFKKLLADDPFFRVPAVVEELCTTRVLGME-LAGGIPLDQCQGLSQDIRNQI-- 342

  Fly   286 FAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSNLW 350
               ..::.:|....:|...|:.:||:..|.|.   ..:|.::.|||.|    .:..|..::::.:
  Rat   343 ---CFQLLRLCLRELFEFRFMQTDPNWANFLY---DASSHKVTLLDFG----ASRAFGTEFTDHY 397

  Fly   351 LSILKV----DRKAMRQHSEQL----GIKGDLYG---LFACMVTGRPW-----------ETV--M 391
            :.::|.    ||..:.|.|:.|    |.:...:.   :.|.|:.|.|:           ||.  :
  Rat   398 IEVVKAAADGDRDRVLQKSQDLKFLTGFETKAFSDAHVEAVMILGEPFAASGSYDFGAGETARRI 462

  Fly   392 QGLTKV 397
            |||..|
  Rat   463 QGLIPV 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 69/266 (26%)
Coq8bNP_001012065.1 KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 151..154 1/2 (50%)
ABC1_ADCK3 171..420 CDD:270872 68/265 (26%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 212..215 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.