DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck1 and SPBC21C3.03

DIOPT Version :9

Sequence 1:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_596583.2 Gene:SPBC21C3.03 / 2540293 PomBaseID:SPBC21C3.03 Length:692 Species:Schizosaccharomyces pombe


Alignment Length:429 Identity:98/429 - (22%)
Similarity:160/429 - (37%) Gaps:131/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YIKVGQHIGALEYLLPKEFVQTMKVLHSDA-------PQNPIEDLYKVIRQDLHCNPEEIFDSFE 151
            :||:||...:...|.|..|.:|:..|||..       .|:.|...|||.      :.||||.:|.
pombe   209 FIKLGQWAASRTDLFPPAFCKTLSKLHSHVTPHSLAYTQSVICKTYKVE------SIEEIFVNFN 267

  Fly   152 REPLGTASLAQVHKARLK-----------TGEL------------------VAVKVQHPYVKGNS 187
            ..|:|..::|||:.|.:|           |..|                  ||:||.||.|:...
pombe   268 PIPIGVGAIAQVYTATIKKAATQQDNSYFTSMLQSIGFRQKNISDAPVTQDVAIKVLHPNVEKYI 332

  Fly   188 RVDMKTMELAVNVLARIFPDFKIHWLVEESKKNLPIELD----FLNEGRNAEKVA-------KQF 241
            .:|::.:..... |..:.|..|  ||      :||.|:.    .||:..|....|       ..|
pombe   333 SLDLQILGFFAK-LINLVPSMK--WL------SLPDEVKVFGAMLNQQLNLHYEALHLNQFRLNF 388

  Fly   242 KKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVTDLDYIRRNKIDSF--AVANRIGQLYSEMIFRTG 304
            :...::..|..|..|:::::|:.:|:.|   ..|....::|...|  .:||.......:|:....
pombe   389 RGNRYVEFPAPYDDYTTNQILLEDYMPG---IPLSAFLKHKSGPFNKLLANTGNNALFQMLIVDN 450

  Fly   305 FVHSDPHPGNILVRRTPENSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQLG 369
            |.|:|.||||:||                       ||   |..:..:|...|.:          
pombe   451 FTHADLHPGNVLV-----------------------KF---YKGIPKTIFNQDNE---------- 479

  Fly   370 IKGDLYGLFACMVTGRPWETVMQGLTKVKY----------------SKEEKNTLQ---------- 408
            |...:|.:.:...| ..|::.|:.|..:.|                ::::||.|.          
pombe   480 INDSIYKILSTCST-EEWDSAMEELNILGYRPTLVFLDAGLVTKLSTQDQKNFLDLFQAVLTFHG 543

  Fly   409 NNTSLVLPHISDVLEQVDRQMLLILKTNDLIRGIE-STL 446
            ....|::...|...|:|..:.:..||...|:..|: |||
pombe   544 YEAGLLMVERSRQTERVINKDIFALKMEHLLNEIQKSTL 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 69/299 (23%)
SPBC21C3.03NP_596583.2 AarF 131..685 CDD:223733 98/429 (23%)
ADCK2-like 233..576 CDD:270873 86/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.