DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42360 and ZC3H12A

DIOPT Version :10

Sequence 1:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_079355.2 Gene:ZC3H12A / 80149 HGNCID:26259 Length:599 Species:Homo sapiens


Alignment Length:174 Identity:75/174 - (43%)
Similarity:104/174 - (59%) Gaps:11/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 PTEEAGEASNKPKTNKRFVIIDGSNVAFAHGNSNVFSSEGIKYCLQYFEKMGH-EVKAVVPMFRK 390
            |.||      |..::.|.|:|||||||.:|||..|||..||...:.:|.:.|| ::...||.:||
Human   126 PEEE------KEGSDLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRK 184

  Fly   391 NNFKSSNP----ELLDKLHKEGKIVFTPCKNIPGQITSSYDDRFILQLAYEKNAAVVSNDNYRDL 451
            ...:...|    .:|.:|.|:..:||||.:.:.|:....||||||::||||.:..|||||.||||
Human   185 EQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDL 249

  Fly   452 INENPAFKLIVENRVLGYSWCDNIFILPKDPYGRWGPTLDEILR 495
            ..|...:|..:|.|:|.||:.::.|:.|.||.||.||:||..||
Human   250 QGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286 56/128 (44%)
ZC3H12ANP_079355.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Ubiquitin association domain. /evidence=ECO:0000250|UniProtKB:Q5D1E7 42..87
UBA_6 49..89 CDD:407876
Necessary for interaction with TANK. /evidence=ECO:0000269|PubMed:25861989 81..150 13/29 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..133 4/12 (33%)
RNase. /evidence=ECO:0000305|PubMed:22561375 112..297 75/174 (43%)
PIN_Zc3h12-like 138..268 CDD:350296 56/129 (43%)
RNA binding. /evidence=ECO:0000305|PubMed:22561375 214..220 1/5 (20%)
Necessary for interaction with ZC3H12D. /evidence=ECO:0000269|PubMed:26134560 301..457
zf-CCCH_2 305..323 CDD:464217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..546
Regnase_1_C 550..593 CDD:465803
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.