DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42360 and NYNRIN

DIOPT Version :10

Sequence 1:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_079357.2 Gene:NYNRIN / 57523 HGNCID:20165 Length:1898 Species:Homo sapiens


Alignment Length:167 Identity:64/167 - (38%)
Similarity:99/167 - (59%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 AGEASNKPKTNKRFVIIDGSNVAFAHGNSNVFSSEGIKYCLQYFEKMGH-EVKAVVPMFR-KNNF 393
            :||..|:   ..|.|:||||:||..||..:.||..||...:|:|...|| ||...||.:: |.|.
Human   784 SGEPGNQ---GLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQFFWNRGHREVTVFVPTWQLKKNR 845

  Fly   394 KSSNPELLDKLHKEGKIVFTPCKNIPGQITSSYDDRFILQLAYEKNAAVVSNDNYRDLINENPAF 458
            :......|.|||....:..||.:...|:..::||.||:::||.|.:..:|:|:....|:|.:.  
Human   846 RVRESHFLTKLHSLKMLSITPSQLENGKKITTYDYRFMVKLAEETDGIIVTNEQIHILMNSSK-- 908

  Fly   459 KLIVENRVLGYSWCDNIFILPKDPYGRWGPTLDEILR 495
            ||:|::|:|.:::..|:|::|.||.||.||||||.|:
Human   909 KLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFLK 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286 46/125 (37%)
NYNRINNP_079357.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1019
RT_RNaseH_2 1130..1230 CDD:465567
Integrase_H2C2 1536..1589 CDD:465569
KH-I_N4BP1_like_rpt1 12..73 CDD:411808
KH-I_NYNRIN_like 75..140 CDD:411905
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..315
PHA03247 <396..726 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..691
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..731
PIN_N4BP1-like 795..919 CDD:350295 46/125 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.