DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42360 and ZC3H12D

DIOPT Version :10

Sequence 1:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_997243.2 Gene:ZC3H12D / 340152 HGNCID:21175 Length:527 Species:Homo sapiens


Alignment Length:157 Identity:66/157 - (42%)
Similarity:102/157 - (64%) Gaps:5/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 RFVIIDGSNVAFAHGNSNVFSSEGIKYCLQYFEKMGHE-VKAVVPMFRKNNFKSSNP----ELLD 402
            |.::|||||||.:|||...||..|||..:.:|...||. :|..||.:||:..::..|    .:|.
Human    90 RPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLA 154

  Fly   403 KLHKEGKIVFTPCKNIPGQITSSYDDRFILQLAYEKNAAVVSNDNYRDLINENPAFKLIVENRVL 467
            :|.::..:|:||.:.:.|:....||||:|:::|||::..:|||||||||.:|||.:|..:|.|:|
Human   155 ELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLL 219

  Fly   468 GYSWCDNIFILPKDPYGRWGPTLDEIL 494
            .:|:.::.|:.|.||.||.||:|...|
Human   220 MFSFVNDRFMPPDDPLGRHGPSLSNFL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286 54/128 (42%)
ZC3H12DNP_997243.2 UBA_6 3..44 CDD:407876
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..75
PIN_Zc3h12-like 92..222 CDD:350296 54/129 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..258 7/13 (54%)
Necessary for interaction with ZC3H12A. /evidence=ECO:0000269|PubMed:26134560 259..356
zf-CCCH_2 260..277 CDD:464217
PRK07764 <286..482 CDD:236090
PHA03215 <286..350 CDD:223010
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..339
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..457
Regnase_1_C 475..>510 CDD:465803
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.