DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42360 and Zc3h12d

DIOPT Version :10

Sequence 1:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001100939.1 Gene:Zc3h12d / 308266 RGDID:1597152 Length:533 Species:Rattus norvegicus


Alignment Length:167 Identity:73/167 - (43%)
Similarity:106/167 - (63%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 EASNKPKTNKRFVIIDGSNVAFAHGNSNVFSSEGIKYCLQYFEKMGHE-VKAVVPMFRKNNFKSS 396
            ||...|.:..|.::|||||||.:|||...||..||:..:.:|...||. :|..||.:||...:|.
  Rat    83 EAGGDPASFLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFRDRGHTYIKVFVPSWRKEPSRSD 147

  Fly   397 NP----ELLDKLHKEGKIVFTPCKNIPGQITSSYDDRFILQLAYEKNAAVVSNDNYRDLINENPA 457
            .|    .:|::|.::..:|:||.:.:.|:....||||:|::|||||:..:|||||||||.||||.
  Rat   148 TPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKLAYEKDGVIVSNDNYRDLQNENPE 212

  Fly   458 FKLIVENRVLGYSWCDNIFILPKDPYGRWGPTLDEIL 494
            :|..:|.|:|.:|:.::.|:.|.||.||.||||...|
  Rat   213 WKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286 57/128 (45%)
Zc3h12dNP_001100939.1 UBA_6 6..44 CDD:407876
PIN_Zc3h12-like 95..225 CDD:350296 57/129 (44%)
PHA03247 <233..503 CDD:223021 10/17 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.