DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42360 and CCDC59

DIOPT Version :10

Sequence 1:NP_611946.2 Gene:CG42360 / 37937 FlyBaseID:FBgn0259742 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_054886.2 Gene:CCDC59 / 29080 HGNCID:25005 Length:241 Species:Homo sapiens


Alignment Length:106 Identity:24/106 - (22%)
Similarity:49/106 - (46%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KGFKKIRGPKPKNGQKRLKRNATQKKA---LNREMVSKFLNSIKKKYALQKNHHIK--RRLDFRR 134
            :||...|..|.:...|:|.|.  :|||   |..:...::.:::|..|..::..|.|  |::|...
Human    53 QGFAFRRKLKIQQSYKKLLRK--EKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPL 115

  Fly   135 RESP-----EKKNALPKPKFYNPNKNDNKKEEGEIVTELDS 170
            .|..     |::.::.:|.|.:....|..:.|.:.:..::|
Human   116 SEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42360NP_611946.2 PIN_Zc3h12a-N4BP1-like 345..469 CDD:350286
CCDC59NP_054886.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
rRNA_processing <160..238 CDD:400708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.