DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4707 and PLAG1

DIOPT Version :10

Sequence 1:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_002646.2 Gene:PLAG1 / 5324 HGNCID:9045 Length:500 Species:Homo sapiens


Alignment Length:236 Identity:58/236 - (24%)
Similarity:106/236 - (44%) Gaps:22/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 KAEPKEKRIYQCEKCPKSFTTKAAMEYHDVSKHVPKSEFKYSCPECNKKIPTERKLKEHLRYMHD 480
            :.|.|.::.:.|:.|.|:|.:...::.|..| |..:..:|....:|.|...::.||:.|:. .|.
Human    25 RGETKPRKNFPCQLCDKAFNSVEKLKVHSYS-HTGERPYKCIQQDCTKAFVSKYKLQRHMA-THS 87

  Fly   481 PEAAIICDKCGKTLRSQTNLKKH---HELEHSEKPRPKPDPVQCEICGTWLRHLSGLKQHMKTVH 542
            ||....|:.|.|....:.:||.|   |:        |..:..:||.||.......|.|:|: .:|
Human    88 PEKTHKCNYCEKMFHRKDHLKNHLHTHD--------PNKETFKCEECGKNYNTKLGFKRHL-ALH 143

  Fly   543 EPPGDEHRCHICNKTSTNSRALKRHIYHNH-------LCERKFKCGMCEKAFKRPQDLREHTSTH 600
            .....:..|.:|.:|..::..|..|: .:|       :.|:|.:|..|::.|...:|:|.|...|
Human   144 AATSGDLTCKVCLQTFESTGVLLEHL-KSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVH 207

  Fly   601 TGEVLYTCPNCPMTFFSNANMYKHRQRLHRAEWEADRKKPL 641
            ||...:.|..|...|....::.:|.::.|..|....:.:|:
Human   208 TGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4707NP_611944.1 zf-AD 3..77 CDD:462262
C2H2 Zn finger 334..355 CDD:275368
LIM <361..407 CDD:413332
C2H2 Zn finger 365..382 CDD:275368
C2H2 Zn finger 390..410 CDD:275368
C2H2 Zn finger 427..443 CDD:275368 4/15 (27%)
COG5236 <455..>574 CDD:227561 31/128 (24%)
C2H2 Zn finger 458..476 CDD:275368 5/17 (29%)
C2H2 Zn finger 487..507 CDD:275368 7/22 (32%)
C2H2 Zn finger 521..540 CDD:275368 7/18 (39%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
C2H2 Zn finger 580..600 CDD:275368 6/19 (32%)
C2H2 Zn finger 608..629 CDD:275368 4/20 (20%)
PLAG1NP_002646.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 1/4 (25%)
Interaction with KPNA2. /evidence=ECO:0000269|PubMed:11882654 2..84 15/59 (25%)
Nuclear localization signal 22..25 58/236 (25%)
C2H2 Zn finger 36..56 CDD:275368 6/20 (30%)
Decreased nuclear import with localization in the nucleus but also in the cytoplasm 41..242 53/212 (25%)
SFP1 <58..139 CDD:227516 23/89 (26%)
C2H2 Zn finger 64..86 CDD:275368 5/22 (23%)
zf-H2C2_2 79..101 CDD:463886 8/22 (36%)
C2H2 Zn finger 94..114 CDD:275368 6/19 (32%)
C2H2 Zn finger 123..143 CDD:275368 7/20 (35%)
C2H2 Zn finger 152..172 CDD:275368 5/20 (25%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 215..233 CDD:275368 4/17 (24%)
Activates transcription, Inhibition of nuclear import due to lack of NLS and KPNA2 interaction 243..500 1/6 (17%)
Repression domain, contains 3 sumoylation motifs and massively decrease transcription activity 243..384 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..388
Massively activates transcription 385..500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.