DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4707 and CG17568

DIOPT Version :9

Sequence 1:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:695 Identity:140/695 - (20%)
Similarity:232/695 - (33%) Gaps:239/695 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CVLCL-DSSNAGYGLQSEEGVRLN----IRATIHKHFAFSEVLTAGGDAEVCRECWNCVSSFEEF 63
            |.||. |.::....:|..|..:.|    :...|.|:|.....|.....:.:|.||:..:|...:|
  Fly    11 CRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELIDF 75

  Fly    64 HQRVSCLH------RQRSSDSKSE--------PIEFCGQTEEAIINPLYSVELDALAEAFFAPSE 114
            .:.|:.:.      |:..:|...|        ....|......||.|:.::|::: ...:..|:|
  Fly    76 AEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMES-DNVYQKPAE 139

  Fly   115 VKVEVNELEPLPKVELLEDPVKTEIRTAPKRLGVPNEGSPHSKRRIKNELPVDSDSDAPLADFLN 179
            :      |:..|..|.....::...||....|       ..:|:.::.|:|..        :|::
  Fly   140 L------LKDFPLAETSSQEMEISKRTTTTHL-------IQTKKNVEMEIPKQ--------EFID 183

  Fly   180 SDSKRSSVGP---AKNSEANKGRQLRRSARRGRPPKAKPESAPSPKKELDSEDGEENARDNNDME 241
                   :||   .||:                             .:||.||            
  Fly   184 -------LGPILLEKNT-----------------------------SQLDMED------------ 200

  Fly   242 FVAPEAVLGTDDSSSSSSESSGEDSDHSLPDIEPEERYAEIPKRVVVKPKKYRKREKPLVPPVRL 306
                  ||                                                         
  Fly   201 ------VL--------------------------------------------------------- 202

  Fly   307 SREEIERRKLQQDEYDEIILQFFKKFPCSLCNLLVQNFADMRRHQRVSHNIESGYIECCGRKFHL 371
              :|:.:.:|.|...|.      ...|.|:.|                 :::|..::.|      
  Fly   203 --DELPQEELSQPRLDS------TTSPASMEN-----------------DVKSEMLDSC------ 236

  Fly   372 RKALAEHVLVHKNPDHFMCSQCGRVFQDSRALEVHEQTHTNP---EVKAEPKEKR-IYQCEKCPK 432
                       :..|.|:.       .|.:.::: ....|.|   |..||.|.|| ...||||.|
  Fly   237 -----------EGDDDFLP-------VDGQLMDL-VAVATTPNTLESTAEEKAKRGRMDCEKCGK 282

  Fly   433 SFTTKAAMEYH------DVSKHVPKSEFKYSCPECNKKIPTERKLKEHLRYMHDPEAAIICDKCG 491
            .:..:|:.|.|      .:.:.|...:...:|..|||.:.:...||.|...:|......|||.||
  Fly   283 VYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCG 347

  Fly   492 KTLRSQTNLKKHHELEHSEKPRPKPDPVQCEICGTWLRHLSGLKQHMKTVHEPPGDEHRCHICNK 556
            |.|::.|.|.: |:|.|:|.     .|.:|.:|....::.:.||.|.: :|..|  ...|:||.|
  Fly   348 KQLKTITALNE-HKLVHTES-----RPFECTVCKAGFKNRARLKAHYQ-IHAEP--SFVCNICGK 403

  Fly   557 TSTNSRALKRH-IYHNHLCERKFKCGMCEKAFKRPQDLREHTSTHTGEVLYTCPNCPMTFFSNAN 620
            .....|....| :.|..  ||:.||.:|...|||.:.|:.|..:|||...|.|..|..:|..|||
  Fly   404 KLQTRRTWNMHKVVHTE--ERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNAN 466

  Fly   621 MYKHRQRLHRAEWEADRKKPLPPNI------------MKISQGAT 653
            ...|:.:.|..|.:.:....||..:            .|:.:|.|
  Fly   467 CRSHKLKKHPQEVQQEDGARLPSRLNVPTLDELRVMTQKLPKGTT 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4707NP_611944.1 zf-AD 3..73 CDD:285071 17/79 (22%)
C2H2 Zn finger 334..355 CDD:275368 2/20 (10%)
LIM <361..407 CDD:295319 4/45 (9%)
C2H2 Zn finger 365..382 CDD:275368 1/16 (6%)
C2H2 Zn finger 390..410 CDD:275368 1/19 (5%)
C2H2 Zn finger 427..443 CDD:275368 7/15 (47%)
C2H2 Zn finger 458..476 CDD:275368 7/17 (41%)
C2H2 Zn finger 487..507 CDD:275368 9/19 (47%)
C2H2 Zn finger 521..540 CDD:275368 5/18 (28%)
C2H2 Zn finger 551..572 CDD:275368 7/21 (33%)
C2H2 Zn finger 580..600 CDD:275368 7/19 (37%)
C2H2 Zn finger 608..629 CDD:275368 7/20 (35%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 17/75 (23%)
COG5048 <313..471 CDD:227381 56/168 (33%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 10/20 (50%)
C2H2 Zn finger 371..391 CDD:275368 5/20 (25%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 439..463 CDD:290200 9/23 (39%)
C2H2 Zn finger 454..475 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.