DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Samtor and Bmt2

DIOPT Version :9

Sequence 1:NP_611943.1 Gene:Samtor / 37934 FlyBaseID:FBgn0035035 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_780521.2 Gene:Bmt2 / 101148 MGIID:2141466 Length:403 Species:Mus musculus


Alignment Length:336 Identity:104/336 - (30%)
Similarity:156/336 - (46%) Gaps:67/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EHQRLASIVKSCHESLRQLTKEYG-ATAAWQEHTSPRNAKQLAEYAKAMKQLAAIWETNDGKVEL 68
            |.::|:.:|||.|..||:..:|.| ....|:||.  .:|:.|.|||.|||.||    .|......
Mouse    30 EQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHC--EDAETLCEYAVAMKNLA----DNHWAKTC 88

  Fly    69 QARSRIKWAIDYITKYFFTEGIYLQKRQREQRLL------------ESYRAEGKLGEVQCRLMEE 121
            :...||:|......:||...|......:.|:|.:            ||.:.||.|    ..|...
Mouse    89 EGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNVHESSKLEGPL----TNLSFT 149

  Fly   122 PPD----------RLHVLDVGSCFNPFSSAPHLEVTALDLCPATEDVLQADFLKVEV-------- 168
            .||          ::.:||||||||||..........:|:.||.|.|.:.|||.:::        
Mouse   150 SPDFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQ 214

  Fly   169 ------VPGIREPELEEGSVRRLPASHYECVIFSLLLEYMPSAEQRLQCCLQAYDLLLPEGILVL 227
                  :..:|.|      :..||...:..|:|||||.|.||..||..||.:|::||:..|:|::
Mouse   215 DAIDAFLKQLRNP------IDALPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLI 273

  Fly   228 ITPDSQHVGKNAHLMKNWRYSLARIGLLRVRFEKLPHISCMVFRKA--------ISRE------L 278
            |||||.|..::|.:||:|:.::..:|..|.::.|..|:..|.|||.        :||.      :
Mouse   274 ITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKTSLKTTSDLVSRNYPGMLYI 338

  Fly   279 SQHWASIHREE 289
            .|.:.|:..||
Mouse   339 PQDFNSVEEEE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SamtorNP_611943.1 AdoMet_MTases 102..>223 CDD:302624 46/156 (29%)
AdoMet_MTases <186..266 CDD:302624 33/79 (42%)
Bmt2NP_780521.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J7Q
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34695
Inparanoid 1 1.050 149 1.000 Inparanoid score I4371
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52239
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007792
OrthoInspector 1 1.000 - - oto92934
orthoMCL 1 0.900 - - OOG6_108162
Panther 1 1.100 - - LDO PTHR21008
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4806
SonicParanoid 1 1.000 - - X5737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.