DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and EFCAB1

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_078869.1 Gene:EFCAB1 / 79645 HGNCID:25678 Length:211 Species:Homo sapiens


Alignment Length:214 Identity:54/214 - (25%)
Similarity:93/214 - (43%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHNELISIVMLYHKFVLVNGPRAKYMTI----QQLSALMELLFEIVDRDLIATIVYRIAHTPGS 93
            |:..|:..::.|::.  ||.|...:.:.:    .....::.:.|.:.| |:|...|:|     |.
Human    20 FNKFEVNCLIKLFYD--LVGGVERQGLVVGLDRNAFRNILHVTFGMTD-DMIMDRVFR-----GF 76

  Fly    94 RPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFVGK--FF--- 153
               |..:|..:::..::...:::....|:.||::.|.|:|      |||:.   |:.|  .|   
Human    77 ---DKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFD------LNGDG---FISKEEMFHML 129

  Fly   154 --------ESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFP-P 209
                    ..||.||.|:   |:.|:...|.|.|.|..:...:|...||.:.:|||.||...| |
Human   130 KNSLLKQPSEEDPDEGIK---DLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDP 191

  Fly   210 NPQMEVLALCANVMSWFDD 228
            ..|||..|......:.|:|
Human   192 KSQMEFEAQVFKDPNEFND 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
EFCAB1NP_078869.1 EFh_PEF <48..170 CDD:330173 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.