DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:143 Identity:34/143 - (23%)
Similarity:60/143 - (41%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSV 131
            ||..:|.:.|:|                     .|.:::||.:::...|:.....:.||.|.|.|
Mouse    68 LMNRVFFVFDKD---------------------GDGYVNLEEWIKGLAVFLRGTFEEKMRFCFEV 111

  Fly   132 YDKSDSKQLNGEQV-GFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR 195
            |..:....::.|:: .......|:...|:|:.|...|:.|:...|.|.|.|..|...::.:.|:.
Mouse   112 YYLNGDAYISQEKIFDMLKSSLFQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKE 176

  Fly   196 QPMLLECFGRVFP 208
            ..:|||.||...|
Mouse   177 DGLLLEAFGPCLP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 14/79 (18%)
EF-hand_7 105..174 CDD:290234 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.