DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Chp2

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:179 Identity:35/179 - (19%)
Similarity:66/179 - (36%) Gaps:57/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMT---IQQLSALMELLFEIVDRDLIATIV 84
            |:..:.:::.||.   .|::.|||:|..::.....:::   :||:.||                 
Mouse    13 DVEHIRRETGFSQ---ASLLRLYHRFQALDRDEKGFLSRLDLQQIGAL----------------- 57

  Fly    85 YRIAHTP-GSRPPDFF---SDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQV 145
               |..| |.|..|.|   ..:.::...|.|:...             |...|:.|:...:.:| 
Mouse    58 ---AVNPLGDRIIDSFFPNGSQRLYFAGFARVLAY-------------FRPIDEEDATLRDPKQ- 105

  Fly   146 GFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
                         .|.:..|::.....|..:|||:|..|..:|..:|:|
Mouse   106 -------------PEPLNSRMNKLRFAFQLYDLDRDGKISRNEMLQVLR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Chp2NP_081639.1 FRQ1 23..179 CDD:227455 34/169 (20%)
Nuclear export signal. /evidence=ECO:0000250 137..148 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.