DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and efcab1

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:199 Identity:52/199 - (26%)
Similarity:91/199 - (45%) Gaps:36/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IARLAKDSIFSHNELISIVMLYHKFVLVNGP----------RAKYMTIQQLSALMELLFEIVDRD 78
            ::||.|.  ||.||:.|::.|||  .||..|          |..:..|      :...|.:.| |
 Frog    13 LSRLIKH--FSKNEVESLIRLYH--TLVGRPIDPNTRRGIDRNTFRNI------LHNTFGMTD-D 66

  Fly    79 LIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGE 143
            :|...|:|     |.   |..:|.:|.:..:|...:|:....|:.::::.|.|||.:....::.|
 Frog    67 MIMDRVFR-----GF---DKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGDGYISRE 123

  Fly   144 QVGFFVG----KFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFG 204
            ::...:.    |....||.||.::   |:.|:...|.|.|.|:.:...::.:.|:.:.:|||.||
 Frog   124 EMFHMLKNSLLKQPSEEDPDEGVK---DLVEIALKKMDYDHDSKLSYMDFEKAVQEENLLLEAFG 185

  Fly   205 RVFP 208
            ...|
 Frog   186 PCLP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 14/67 (21%)
EFh 71..130 CDD:238008 14/66 (21%)
EFh 104..175 CDD:238008 16/73 (22%)
EF-hand_7 105..174 CDD:290234 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.