DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and LOC500007

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_006236139.1 Gene:LOC500007 / 500007 RGDID:1588445 Length:217 Species:Rattus norvegicus


Alignment Length:168 Identity:41/168 - (24%)
Similarity:70/168 - (41%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSV 131
            ||..:|.:.|:|                     .|.|::|:.:::...|:.....:.||.|.|.|
  Rat    68 LMNRVFFVFDKD---------------------GDSHVNLQEWIKGLAVFLRGTFEEKMRFCFEV 111

  Fly   132 YDKSDSKQLNGEQV-GFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR 195
            |..|....::.|:: .......|.:..|:|:.|...|:.|:...|.|.|.|..|..:::.:.||:
  Rat   112 YYLSGDAYISREKIFDMLKSSLFHNSPEEENEEGIKDLVEISLKKMDYDNDGKISFEDFEKAVRK 176

  Fly   196 QPMLLECFGRVFPPNP---QMEVLALCANVMSWFDDSP 230
            ..:|||.||...|...   ..|.|....|..:.|:.:|
  Rat   177 DGLLLEAFGPCLPDAKTCFHFEALVFKNNSPASFEHNP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
LOC500007XP_006236139.1 EFh 104..175 CDD:298682 19/70 (27%)
EF-hand_7 105..174 CDD:290234 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.