DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CG5890

DIOPT Version :10

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:108 Identity:23/108 - (21%)
Similarity:47/108 - (43%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYD-KSDSKQLNGE------QVGFFVGKFFESE 156
            |.|..:.|.:.:| .:||      .::.:.|.:|| ..|.:...||      .:...:|:.....
  Fly    98 FRDLLVTLSTLLR-GSVY------ERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155

  Fly   157 DEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPML 199
            ::|....   |..:.:|.|.||::|..|.::|:.|...:..::
  Fly   156 EDDRKAR---DQVDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CG5890NP_001356889.1 FRQ1 <80..188 CDD:444056 22/99 (22%)

Return to query results.
Submit another query.