DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CG14362

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:190 Identity:38/190 - (20%)
Similarity:76/190 - (40%) Gaps:39/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LAKDSIFSHNELISIVMLYHKFVLVNG----PRAKYMTIQQLSALMELLFEIVDRDLIATIVYRI 87
            |..::..|.:::..:.:.:|:|   :|    |.:........|.|::|      ..|:.||:..:
  Fly    23 LRMNTALSRSQIKYLYIRFHQF---SGGGKDPPSHLHKYNFYSGLLQL------NPLLPTILNSM 78

  Fly    88 AHTPGSRPPDFFSDKHIHLESFV--RLFTVYFTKDLQL--KMEFAFSVYDKSDSKQLNGEQVGFF 148
            .   |::....|.|..:.|.:|.  .|.|....|::.:  |:...|::||.:...::....:...
  Fly    79 F---GNKVTITFVDFALFLSTFQAHSLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVV 140

  Fly   149 VGKFFESEDEDESIELRL---DMKEM---------------LFLKFDLDKDTNIGVDEYY 190
            |.|.|.:..:...| :|:   .||||               .|..||:.:.....:.||:
  Fly   141 VHKLFSNLLDHVQI-MRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMMVTWIPEYH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CG14362NP_650320.1 EFh 116..183 CDD:238008 13/67 (19%)
EF-hand_7 117..182 CDD:290234 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.