DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and d-cup

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:224 Identity:83/224 - (37%)
Similarity:125/224 - (55%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDGSLDTLENARFNYVY---MKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLS 65
            ||.:::...|.||..||   :..||||..   |:.:|:..|:|:|:|:.|.|||.|:.:|..|..
  Fly     3 LDLTMNDRFNQRFQSVYGGLVPQIARLVP---FNDSEVTCILMIYYKYSLQNGPSARRITSSQFV 64

  Fly    66 ALMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFS 130
            .::....::.|.|::..||..||   |.|       ||:....||...|:..::|::.|||||:.
  Fly    65 NIVIGFQQLYDMDVVDRIVTLIA---GGR-------KHVTPMEFVNYMTILMSRDMERKMEFAYM 119

  Fly   131 VYDKSDSKQLNGEQVGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR 195
            |||| :...:|.|.:...|.:||.. |:||.:|:||||.:.|.||||.|:|..|..:||..:|.:
  Fly   120 VYDK-NGMGINREIISSSVERFFVG-DDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEYRSIVLQ 182

  Fly   196 QPMLLECFGRVFPPNPQMEVLALCANVMS 224
            ||.|||..|.:||.:....|:|.|..:.|
  Fly   183 QPRLLEFLGPIFPSDETRLVVAYCTAIYS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
98.860

Return to query results.
Submit another query.