DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and sowi

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster


Alignment Length:227 Identity:81/227 - (35%)
Similarity:128/227 - (56%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLS 65
            |::||.::|::||:||..:|...|..|...|..|..::..::::|:||...|||:.|.||.:|..
  Fly     1 MENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFY 65

  Fly    66 ALMELLF-----EIVDRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKM 125
            .:..:||     ::::|.|:|...               ..|::...:::.||.:|.|.|:|::|
  Fly    66 QIFLVLFNVASVQVIERTLLAITK---------------DTKYVSPRAWIHLFDLYTTNDIQVRM 115

  Fly   126 EFAFSVYDKSDSKQLNGEQVGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYY 190
            .|||.|||...:..::.||||....|||..|||||..||:.||.|.|..|||||||..|..::|.
  Fly   116 RFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYS 180

  Fly   191 EVVRRQPMLLECFGRVFPPNPQMEVLALCANV 222
            .||.:||:|:|..|.:||.....:::|.|.|:
  Fly   181 TVVEQQPILVEFLGWLFPSKEDKDLMAHCINL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 33/63 (52%)
EFh 116..178 CDD:238008 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
98.860

Return to query results.
Submit another query.