DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Frq2

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster


Alignment Length:185 Identity:43/185 - (23%)
Similarity:85/185 - (45%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIA 88
            |.||..|:.|:..|    :..:||..|.:.|.. .:|.|....:.:..|...|....|::|:|:.
  Fly    13 IDRLTTDTYFTEKE----IRQWHKGFLKDCPNG-LLTEQGFIKIYKQFFPDGDPSKFASLVFRVF 72

  Fly    89 HTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQ-------VG 146
                    |..:|..|..|.|:|..::....:|..|:.:||.:||..:...:..|:       :.
  Fly    73 --------DENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIY 129

  Fly   147 FFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLE 201
            ..||:..::|||: :.:.|:|   .:|.:.|.:.|..:.::|:.|..:..|.:::
  Fly   130 QMVGQQPQTEDEN-TPQKRVD---KIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 43/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.