DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CG2256

DIOPT Version :10

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLS 65
            |.:|.|.::.           |.:..|.|.:.|:.:||.::..:|.|.|......||.:.....|
  Fly   101 MDELSGKVNP-----------KLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSS 154

  Fly    66 ALM----------------ELL---FEIVDRDLIATIVYRIAHTPGSRPPDFFS-DK-H----IH 105
            |.:                |||   |:||..::   ::.||          |.| || |    :.
  Fly   155 AAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEI---LMERI----------FCSWDKAHEGLPLR 206

  Fly   106 LESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFV-GKFF-----------ESEDE 158
            ||.::...:.:.......:..|.|.|||      ||.:  ||.. .:.|           :.||.
  Fly   207 LEGWLIGLSTFLRGTPAERAAFCFRVYD------LNTD--GFITKDEMFTLLRNCLIKQPQDEDP 263

  Fly   159 DESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFPPNPQMEVLALCANVM 223
            ||.::   |:.|::..|||||||..:.::::...|..:|:|:|.||:..|.:         :.|:
  Fly   264 DEGVK---DLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQCLPTD---------SAVV 316

  Fly   224 SWF 226
            |:|
  Fly   317 SFF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CG2256NP_572437.2 PRK12309 <103..290 CDD:183426 53/221 (24%)
EF-hand_7 224..292 CDD:463900 23/78 (29%)

Return to query results.
Submit another query.