DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CG32812

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster


Alignment Length:126 Identity:26/126 - (20%)
Similarity:41/126 - (32%) Gaps:48/126 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SKQLNGEQVGFFVGKFFESEDEDESIELRLDMKEMLFLKF-DLDKDTNIGVDEYYEVVRRQPMLL 200
            |:|||..|:.          |..::..|..:..|.|..:| .||:...                 
  Fly     6 SRQLNPVQLC----------DHQQATGLSAEQLEQLHTRFRSLDRHQR----------------- 43

  Fly   201 ECFGRVFPPN----PQMEVLALCANVMSWFDDS--PNPRIMIK-----------PDGGKAS 244
               |.:.|.:    ||:.:..|...::..|..|  |:.||..|           |..|:.|
  Fly    44 ---GYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGS 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 18/91 (20%)
EF-hand_6 117..139 CDD:290141
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.