DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and KCNIP2

DIOPT Version :10

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_055406.2 Gene:KCNIP2 / 30819 HGNCID:15522 Length:285 Species:Homo sapiens


Alignment Length:194 Identity:38/194 - (19%)
Similarity:72/194 - (37%) Gaps:43/194 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IARLAKDSIFSHNELISIVMLYHKFV------LVNGPRAKYMTIQQLSALMELLFEIVDRDLIAT 82
            :.:|.:.:.|:..||   .:||..|.      :||....|.:..|        .|...|....||
Human   108 LEQLQEQTKFTRKEL---QVLYRGFKNECPSGIVNEENFKQIYSQ--------FFPQGDSSTYAT 161

  Fly    83 IVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQ--- 144
            .::....|.        .|..:..|.||...:|.....:..::.:||::||.:....:..|:   
Human   162 FLFNAFDTN--------HDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLD 218

  Fly   145 ----VGFFVGKF----FESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLL 200
                :...:||:    ...|...|.:       |..|.|.|.:||..:.::|:.|..::...::
Human   219 IMKSIYDMMGKYTYPALREEAPREHV-------ESFFQKMDRNKDGVVTIEEFIESCQKDENIM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
KCNIP2NP_055406.2 EF-hand_8 134..184 CDD:404678 13/65 (20%)
FRQ1 <163..270 CDD:444056 23/121 (19%)

Return to query results.
Submit another query.