DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Efcab1

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:211 Identity:52/211 - (24%)
Similarity:83/211 - (39%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSHNELISIVMLYHKFV--------LVNG-PRAKYMTIQQLS------ALMELLFEIVDRDLIAT 82
            |:..|:..::.|::..|        :|.| .|..:..|..::      .:|:.:|...|||    
  Rat    20 FNKFEVKCLITLFYNLVGDVPEKPGVVTGLDRNVFRNILHVTFGMTDDMIMDRVFRGFDRD---- 80

  Fly    83 IVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGF 147
                             :|..|.:..:|...:::....|..||::.|.|:|      |||:.   
  Rat    81 -----------------NDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFD------LNGDG--- 119

  Fly   148 FVGK--FF-----------ESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPML 199
            |:.|  .|           ..||.||.|:   |:.|:...|.|.|.|..:...:|...||.:.:|
  Rat   120 FISKEEMFHMLKNSLLKQPSEEDPDEGIK---DLVEITLKKMDHDHDGKLSFVDYETAVREETLL 181

  Fly   200 LECFGRVFP-PNPQME 214
            ||.||...| |..|||
  Rat   182 LEAFGPCLPDPKRQME 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 20/89 (22%)
EFh 72..131 CDD:238008 19/88 (22%)
EFh 105..168 CDD:238008 22/74 (30%)
EF-hand_7 106..175 CDD:290234 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.