powered by:
Protein Alignment CG3565 and Tescl
DIOPT Version :9
Sequence 1: | NP_611942.1 |
Gene: | CG3565 / 37933 |
FlyBaseID: | FBgn0035034 |
Length: | 244 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099703.1 |
Gene: | Tescl / 292706 |
RGDID: | 1311676 |
Length: | 232 |
Species: | Rattus norvegicus |
Alignment Length: | 58 |
Identity: | 16/58 - (27%) |
Similarity: | 26/58 - (44%) |
Gaps: | 10/58 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 DEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFPPNPQME 214
:::|:.:.|.:..:.||..:|.|.|..|.:.||..||. .:...|||.|
Rat 117 NKEEAEQYRKEKMQFLFNMYDQDGDGIITLQEYRRVVE----------DLLSANPQAE 164
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3565 | NP_611942.1 |
None |
Tescl | NP_001099703.1 |
PTZ00183 |
30..206 |
CDD:185503 |
16/58 (28%) |
EFh |
128..>165 |
CDD:298682 |
14/47 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.