DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Tesc

DIOPT Version :10

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_006249488.1 Gene:Tesc / 288689 RGDID:1566317 Length:247 Species:Rattus norvegicus


Alignment Length:70 Identity:20/70 - (28%)
Similarity:31/70 - (44%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DESIEL-RLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR----QPMLLECFGRVFPPNPQMEVLAL 218
            :|.:|| |.:..:.||..:|.|.|..|.::||..||..    .|.:.:...|.......||..::
  Rat   137 EEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASV 201

  Fly   219 CANVM 223
            |...|
  Rat   202 CVGQM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
TescXP_006249488.1 EF-hand_7 92..172 CDD:463900 12/34 (35%)
EF-hand_7 145..225 CDD:463900 16/62 (26%)
EFh 147..>175 CDD:415501 10/27 (37%)

Return to query results.
Submit another query.